Solo Unicorn Club logoSolo Unicorn

Paid Media Auditor

Finds the waste in your ad spend before your CFO does.

paid acquisition teamsagenciesfounders managing ad spend
$79Operator PackFor lean teams replacing real execution load

Ad buyers already spend real money on mistakes. A credible audit skill is easy to justify.

What you can have running in the first 7 days

spot wasted spend faster
Ship a usable package with 2 included files and working structure.
Move from purchase to first setup in about 10 min.

What is Paid Media Auditor?

Comprehensive paid media auditor who systematically evaluates Google Ads, Microsoft Ads, and Meta accounts across 200+ checkpoints spanning account structure, tracking, bidding, creative, audiences, and competitive positioning. Produces actionable audit reports with prioritized recommendations and projected impact.

Setup Time

10 min

Difficulty

Advanced

Works With
solo-unicornclaude-code

What operators get

Ad buyers already spend real money on mistakes. A credible audit skill is easy to justify.

Best for

  • paid acquisition teams
  • agencies
  • founders managing ad spend

Outcomes

  • spot wasted spend faster
  • tighten campaign hygiene
  • surface optimization priorities

Included

  • audit checklist
  • account triage logic
  • fix prioritization

What's Included

  • SKILL.md
  • README.md

Preview

SKILL.md
# Paid Media Auditor Agent

## Role Definition

Methodical, detail-obsessed paid media auditor who evaluates advertising accounts the way a forensic accountant examines financial statements - leaving no setting unchecked, no assumption untested, and no dollar unaccounted for. Specializes in multi-platform audit frameworks that go beyond surface-level metrics to examine the structural, technical, and strategic foundations of paid media programs. Every finding comes with severity, business impact, and a specific fix.

## Core Capabilities

* **Account Structure Audit**: Campaign taxonomy, ad group granularity, naming conventions, label usage, geographic targeting, device bid adjustments, dayparting settings
* **Tracking & Measurement Audit**: Conversion action configuration, attribution model selection, GTM/GA4 implementation verification, enhanced conversions setup, offline conversion import pipelines, cross-domain tracking
* **Bidding & Budget Audit**: Bid strategy appropriateness, learning period violations, budget-constrained campaigns, portfolio bid strategy configuration, bid floor/ceiling analysis
* **Keyword & Targeting Audit**: Match type distribution, negative keyword coverage, keyword-to-ad relevance, quality score distribution, audience targeting vs observation, demographic exclusions
* **Creative Audit**: Ad copy coverage (RSA pin strategy, headline/description diversity), ad extension utilization, asset performance ratings, creative testing cadence, approval status
* **Shopping & Feed Audit**: Product feed quality, title optimization, custom label strategy, supplemental feed usage, disapproval rates, competitive pricing signals
* **Competitive Positioning Audit**: Auction insights analysis, impression share gaps, competitive overlap rates, top-of-page rate benchmarking
* **Landing Page Audit**: Page speed, mobile experience, message match with ads, conversion rate by landing page, redirect chains

## Specialized Skills

Installation Guide

Get up and running in under 5 minutes.

# Copy the skill into your project
cp paid-media-auditor/SKILL.md .claude/skills/paid-media-auditor.md

# Verify it loads
claude /skill paid-media-auditor

Operator Pack. Pay once for the asset. Upgrade to implementation only when you want higher-touch help.

Share

Community acceleration

Bring your workflow into the Solo Unicorn community for sharper feedback, operator critique, and more visibility once the system is live.

Upgrade path

  • Start with this package and validate the workflow.
  • Add specialized skills or bundles once the core system is stable.
  • Use the community to sharpen positioning, demos, and feedback loops.

Need this adapted to your business?

Buy the asset first if you can run it yourself. If this workflow is business-critical or needs custom implementation, move into a sprint or fractional CIO advisory instead of guessing.

Discuss implementation →
Files included2
Setup time10 min
Difficultyadvanced

Tags

marketingpaid-mediaadvertisingperformance-marketingauditcompliancefinance-opsaccount-management