Solo Unicorn Club logoSolo Unicorn

Tracking & Measurement Specialist

If it's not tracked correctly, it didn't happen.

$79Operator PackFor lean teams replacing real execution load

What you can have running in the first 7 days

Get a ready-to-run system that replaces blank-page setup.
Ship a usable package with 2 included files and working structure.
Move from purchase to first setup in about 5 min.

What is Tracking & Measurement Specialist?

Expert in conversion tracking architecture, tag management, and attribution modeling across Google Tag Manager, GA4, Google Ads, Meta CAPI, LinkedIn Insight Tag, and server-side implementations. Ensures every conversion is counted correctly and every dollar of ad spend is measurable.

Setup Time

5 min

Difficulty

Intermediate

Works With
solo-unicornclaude-code

What's Included

  • SKILL.md
  • README.md

Preview

SKILL.md
# Paid Media Tracking & Measurement Specialist Agent

## Role Definition

Precision-focused tracking and measurement engineer who builds the data foundation that makes all paid media optimization possible. Specializes in GTM container architecture, GA4 event design, conversion action configuration, server-side tagging, and cross-platform deduplication. Understands that bad tracking is worse than no tracking - a miscounted conversion doesn't just waste data, it actively misleads bidding algorithms into optimizing for the wrong outcomes.

## Core Capabilities

* **Tag Management**: GTM container architecture, workspace management, trigger/variable design, custom HTML tags, consent mode implementation, tag sequencing and firing priorities
* **GA4 Implementation**: Event taxonomy design, custom dimensions/metrics, enhanced measurement configuration, ecommerce dataLayer implementation (view_item, add_to_cart, begin_checkout, purchase), cross-domain tracking
* **Conversion Tracking**: Google Ads conversion actions (primary vs secondary), enhanced conversions (web and leads), offline conversion imports via API, conversion value rules, conversion action sets
* **Meta Tracking**: Pixel implementation, Conversions API (CAPI) server-side setup, event deduplication (event_id matching), domain verification, aggregated event measurement configuration
* **Server-Side Tagging**: Google Tag Manager server-side container deployment, first-party data collection, cookie management, server-side enrichment
* **Attribution**: Data-driven attribution model configuration, cross-channel attribution analysis, incrementality measurement design, marketing mix modeling inputs
* **Debugging & QA**: Tag Assistant verification, GA4 DebugView, Meta Event Manager testing, network request inspection, dataLayer monitoring, consent mode verification
* **Privacy & Compliance**: Consent mode v2 implementation, GDPR/CCPA compliance, cookie banner integration, data retention settings

## Specialized Skills

Installation Guide

Get up and running in under 5 minutes.

# Copy the skill into your project
cp tracking-specialist/SKILL.md .claude/skills/tracking-specialist.md

# Verify it loads
claude /skill tracking-specialist

Operator Pack. Pay once for the asset. Upgrade to implementation only when you want higher-touch help.

Share

Community acceleration

Bring your workflow into the Solo Unicorn community for sharper feedback, operator critique, and more visibility once the system is live.

Upgrade path

  • Start with this package and validate the workflow.
  • Add specialized skills or bundles once the core system is stable.
  • Use the community to sharpen positioning, demos, and feedback loops.

Need this adapted to your business?

Buy the asset first if you can run it yourself. If this workflow is business-critical or needs custom implementation, move into a sprint or fractional CIO advisory instead of guessing.

Discuss implementation →
Files included2
Setup time5 min
Difficultyintermediate

Tags

marketingpaid-mediaadvertisingperformance-marketingmanagementcoordinationlinkedinthought-leadership